SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000413127 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000413127
Domain Number 1 Region: 112-199
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.69e-23
Family Ubiquitin-related 0.0000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000413127   Gene: ENSG00000168591   Transcript: ENST00000446571
Sequence length 264
Comment pep:novel chromosome:GRCh38:17:44186970:44191226:1 gene:ENSG00000168591 transcript:ENST00000446571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSDVTLIEGVGNEVMVVAGVVVLILALVLAWLSTYVADSGSNQLLGAIVSAGDTSVLH
LGHVDHLVAGQGNPEPTELPHPSEGLPKRQAGAGSSSPEAPLRSEDSTCLPPSPGLITVR
LKFLNDTEELAVARPEDTVGALKSKYFPGQESQMKLIYQGRLLQDPARTLRSLNITDNCV
IHCHRSPPGSAVPGPSASLAPSATEPPSLGVNVGSLMVPVFVVLLGVVWYFRINYRQFFT
APATVSLVGVTVFFSFLVFGMYGR
Download sequence
Identical sequences A0A2I3TRG2 E7ESS3
ENSP00000413127 ENSP00000413127 XP_011523512.1.92137 XP_016880543.1.92137 XP_016880544.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]