SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000413128 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000413128
Domain Number 1 Region: 19-180
Classification Level Classification E-value
Superfamily Rhomboid-like 0.000000000000863
Family Rhomboid-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000413128   Gene: ENSG00000100263   Transcript: ENST00000414672
Sequence length 195
Comment pep:known chromosome:GRCh38:22:29260812:29268209:-1 gene:ENSG00000100263 transcript:ENST00000414672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHARGPHGQLSPALPLASSVLMLLMSTLWLVGAGPGLVLAPELLLDPWQVHRLLTHALGH
TALPGLLLSLLLLPTVGWQQECHLGTLRFLHASALLALASGLLAVLLAGLGLSSAAGSCG
YMPVHLAMLAGEGHRPRRPRGALPPWLSPWLLLALTPLLSSEPPFLQLLCGLLAGLAYAA
GAFRWLEPSERRLQV
Download sequence
Identical sequences B0QYJ1
ENSP00000413128 ENSP00000413128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]