SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000413309 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000413309
Domain Number 1 Region: 2-73
Classification Level Classification E-value
Superfamily Globin-like 0.0000000000000275
Family Globins 0.000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000413309   Gene: ENSG00000198125   Transcript: ENST00000442617
Sequence length 74
Comment pep:novel chromosome:GRCh38:22:35607375:35617329:-1 gene:ENSG00000198125 transcript:ENST00000442617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQV
LQSKHPGDFGADAQ
Download sequence
Identical sequences B0QYF7
ENSP00000413309 ENSP00000413309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]