SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000413399 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000413399
Domain Number - Region: 36-96
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0628
Family Transglutaminase, two C-terminal domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000413399   Gene: ENSG00000054392   Transcript: ENST00000426968
Sequence length 207
Comment pep:known chromosome:GRCh38:1:210362852:210464655:1 gene:ENSG00000054392 transcript:ENST00000426968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWGKQWLVWLLLGHMVVSQMATLLARKRRWYKTENEYYLLQFTLTVRCLYYTSFSLELC
WQQLPAASTSYSFPWMLAYVFYYPVLHNGPILSFSEFIKQMQQQEHDSLKASLCVLALGL
GRLLCWWWLAELMAHLMYMHAIYSSIPLLETVSCWTLGGLALAQVLFFYVKYLVLFGVPA
LLMRLDGLTPPALPRCVSTMFSFTGMW
Download sequence
Identical sequences A0A075B6R5 A0A2J8QVI4
ENSP00000413399 ENSP00000413399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]