SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000413470 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000413470
Domain Number 1 Region: 9-230
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.88e-30
Family Integrin alpha N-terminal domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000413470   Gene: ENSG00000091409   Transcript: ENST00000412899
Sequence length 231
Comment pep:putative chromosome:GRCh38:2:172427354:172474977:1 gene:ENSG00000091409 transcript:ENST00000412899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVTVQSQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSF
CDGRLRGHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFED
GPYEVGGETEHDESLVPVPANSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKR
DMKSAHLLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDG
Download sequence
Identical sequences A0A2J8PQX7 C9JXX7
ENSP00000413470 ENSP00000413470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]