SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000413511 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000413511
Domain Number 1 Region: 170-254
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 8.24e-22
Family Thyroglobulin type-1 domain 0.00000502
Further Details:      
 
Domain Number 2 Region: 28-110
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.26e-18
Family Growth factor receptor domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000413511   Gene: ENSG00000146678   Transcript: ENST00000457280
Sequence length 257
Comment pep:novel chromosome:GRCh38:7:45888360:45893625:1 gene:ENSG00000146678 transcript:ENST00000457280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCC
PMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGS
PESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIEL
YRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQTSMDGEAGLCWCVYPWNGKRIPGS
PEIRGDPNCQIYFNVQN
Download sequence
Identical sequences C9JXF9
ENSP00000413511 ENSP00000413511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]