SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000413751 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000413751
Domain Number 1 Region: 99-189
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.55e-30
Family Canonical RBD 0.0022
Further Details:      
 
Domain Number 2 Region: 6-87
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.37e-26
Family Canonical RBD 0.0000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000413751   Gene: ENSG00000116001   Transcript: ENST00000416149
Sequence length 214
Comment pep:putative chromosome:GRCh38:2:70216672:70248454:-1 gene:ENSG00000116001 transcript:ENST00000416149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCFVEFHEHRHAA
AALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQRSQDHFHVFVGDLSPEITTE
DIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQMGGQWLGGRQIRTN
WATRKPPAPKSTYECRCIGEEKEMWNFGEKYARF
Download sequence
Identical sequences A0A2J8N484
ENSP00000413751 ENSP00000413751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]