SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000414016 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000414016
Domain Number 1 Region: 40-121
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 4.8e-24
Family MHC antigen-recognition domain 0.00000801
Further Details:      
 
Domain Number 2 Region: 121-185
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000002
Family C1 set domains (antibody constant domain-like) 0.0000626
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000414016   Gene: ENSG00000243719   Transcript: ENST00000451148
Sequence length 227
Comment pep:known chromosome:GRCh38:CHR_HSCHR6_MHC_COX_CTG1:32870929:32875427:-1 gene:ENSG00000243719 transcript:ENST00000451148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLS
EAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKI
PVSRVNWQHHSVPVEGFGPTFVSAVDGLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAI
AYWVPRNALPSDLLENVLCGVAFGLGVLGIIVGIVLIIYFRKPCSGD
Download sequence
Identical sequences Q5SP00
ENSP00000372714 ENSP00000378714 ENSP00000389962 ENSP00000394366 ENSP00000398742 ENSP00000412100 ENSP00000414016 ENSP00000372714 ENSP00000378714 ENSP00000389962 ENSP00000394366 ENSP00000398742 ENSP00000412100 ENSP00000414016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]