SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000414378 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000414378
Domain Number 1 Region: 27-156
Classification Level Classification E-value
Superfamily Cupredoxins 3.47e-43
Family Ephrin ectodomain 0.0000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000414378   Gene: ENSG00000243364   Transcript: ENST00000427683
Sequence length 207
Comment pep:known chromosome:GRCh38:1:155063761:155069538:1 gene:ENSG00000243364 transcript:ENST00000427683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPH
YEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSL
GFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERRARVLPRSPGGGGIPAACTGGANS
DRQDGALMGEIRGSEVTLAGACPLITG
Download sequence
Identical sequences 9606.ENSP00000403005 NP_872631.1.87134 NP_872631.1.92137 ENSP00000414378 gi|33359686|ref|NP_872631.1| ENSP00000414378 ENSP00000414378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]