SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000414741 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000414741
Domain Number - Region: 2-30
Classification Level Classification E-value
Superfamily Globin-like 0.00018
Family Globins 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000414741   Gene: ENSG00000223609   Transcript: ENST00000417377
Sequence length 85
Comment pep:putative chromosome:GRCh38:11:5232930:5234483:-1 gene:ENSG00000223609 transcript:ENST00000417377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHLTPEEKTAVNALWGKVNVDAVGGEALGSSWAMCWCVCWPATLARNSPHKCRLPIRRW
WLVWLMPWLTSTIEILDCFLITIRR
Download sequence
Identical sequences A0A2J8P6R8 C9JRG0
ENSP00000414741 ENSP00000414741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]