SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000414861 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000414861
Domain Number 1 Region: 45-81
Classification Level Classification E-value
Superfamily WW domain 0.0000000267
Family WW domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000414861   Gene: ENSG00000102103   Transcript: ENST00000443648
Sequence length 213
Comment pep:known chromosome:GRCh38:X:48898260:48902793:1 gene:ENSG00000102103 transcript:ENST00000443648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPVALQTRLAKRGILKHLEPEPEEEIIAEDYDDDPVDYEATRLEGLPPSWYKVFDPSC
GLPYYWNADTDLVSWLSPHDPNSVVTKSAKKLRSSNADAEEKLDRSHDKSDRGHDKSDRS
HEKLDRGHDKSDRGHDKSDRDRERGYDKVDRERERDRERDRDRGYDKADREEGKERRHHR
REELAPYPKSKKAVSRKDEELDPMDPSSYSDAP
Download sequence
Identical sequences A0A2J8IQP4
ENSP00000414861 ENSP00000414861 ENSP00000469007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]