SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000415178 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000415178
Domain Number 1 Region: 6-106
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.62e-33
Family CRAL/TRIO domain 0.00000091
Further Details:      
 
Domain Number 2 Region: 110-194
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 9.02e-23
Family Supernatant protein factor (SPF), C-terminal domain 0.00000307
Further Details:      
 
Weak hits

Sequence:  ENSP00000415178
Domain Number - Region: 263-288
Classification Level Classification E-value
Superfamily Thiolase-like 0.0576
Family Thiolase-related 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000415178   Gene: ENSG00000249590   Transcript: ENST00000439838
Sequence length 338
Comment pep:putative chromosome:GRCh38:22:30409262:30428987:1 gene:ENSG00000249590 transcript:ENST00000439838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKE
VLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISR
GSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKTKMGERQRAGEMTEVLPNQRYNSHL
VPEDGTLTCSDPGICYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKGKKAGEVPS
PEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLAVRKWTTTA
LGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS
Download sequence
Identical sequences H7C417
ENSP00000415178 ENSP00000415178 ENSP00000415178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]