SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000415747 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000415747
Domain Number 1 Region: 2-69
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000101
Family WD40-repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000415747   Gene: ENSG00000102054   Transcript: ENST00000425696
Sequence length 85
Comment pep:putative chromosome:GRCh38:X:16839283:16852065:-1 gene:ENSG00000102054 transcript:ENST00000425696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQI
WQMAENIYNDEESDVTTSELEGQGS
Download sequence
Identical sequences A0A2J8W4B2 Q5JNZ6
ENSP00000415747 ENSP00000415747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]