SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000416212 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000416212
Domain Number 1 Region: 8-48,80-149
Classification Level Classification E-value
Superfamily BRCT domain 1.77e-24
Family 53BP1 0.00000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000416212   Gene: ENSG00000067369   Transcript: ENST00000434595
Sequence length 149
Comment pep:novel chromosome:GRCh38:15:43409010:43413286:-1 gene:ENSG00000067369 transcript:ENST00000434595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XTGEPSALEEQRGPLPLNKTLFLGYAFLLTMATTSDKLASRSKLPDGPTGSSEEEEAYCN
HPSQSGLNALPSSPFAFYGHLLEQTHVEEFLEIPPFNKQYTESQLRAGAGYILEDFNEAQ
CNTAYQCLLIADQHCRTRKYFLCLASGIP
Download sequence
Identical sequences H7C495
ENSP00000416212 ENSP00000416212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]