SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000416309 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000416309
Domain Number 1 Region: 95-222
Classification Level Classification E-value
Superfamily GAF domain-like 3.27e-27
Family GAF domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000416309   Gene: ENSG00000138735   Transcript: ENST00000420633
Sequence length 224
Comment pep:putative chromosome:GRCh38:4:119596526:119628065:-1 gene:ENSG00000138735 transcript:ENST00000420633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNAWFAERVHTIPVCKEGIRGHTESCSCPLQQSPRADNSAPGTPTRKISASEFDRPLRP
IVVKDSEGTVSFLSDSEKKEQMPLTPPRFDHDEGDQCSRLLELVKDISSHLDVTALCHKI
FLHIHGLISADRYSLFLVCEDSSNDKFLISRLFDVAEGSTLEEVSNNCIRLEWNKGIVGH
VAALGEPLNIKDAYEDPRFNAEVDQITGYKTQSILCMPIKNHRE
Download sequence
Identical sequences C9JGT3
ENSP00000416309 ENSP00000416309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]