SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000416397 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000416397
Domain Number 1 Region: 36-96,127-163
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.33e-21
Family FAD/NAD-linked reductases, N-terminal and central domains 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000416397   Gene: ENSG00000135297   Transcript: ENST00000415228
Sequence length 192
Comment pep:known chromosome:GRCh38:6:73461765:73501096:1 gene:ENSG00000135297 transcript:ENST00000415228 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MFYFRGCGRWVAVSFTKQQFPLARLSSDSAAPRTPHFDVIVIGGGHAGTEAATAAARCGS
RTLLLTHRVDTIGQMSCNPSFGGIGKGHLMREVDALDGLCSRICDQSGVHYKVLNRRKGP
AVWGLRAQIDRKLYKQNMQKEILNTPLLTVQEGAVEDLILTEPEPEHTGKCRVSGVVLAR
RSAAMLLDSHQP
Download sequence
Identical sequences E7EWI1
ENSP00000416397 ENSP00000416397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]