SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000416515 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000416515
Domain Number 1 Region: 182-405
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.81e-54
Family C-terminal domain of adrenodoxin reductase-like 0.0000000046
Further Details:      
 
Domain Number 2 Region: 30-78,125-239
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.00000000000377
Family N-terminal domain of adrenodoxin reductase-like 0.0000495
Further Details:      
 
Domain Number 3 Region: 374-533
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0000000506
Family N-terminal domain of adrenodoxin reductase-like 0.000000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000416515   Gene: ENSG00000161513   Transcript: ENST00000442102
Sequence length 534
Comment pep:novel chromosome:GRCh38:17:74862542:74873031:-1 gene:ENSG00000161513 transcript:ENST00000442102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLKR
VEALCSQPRVLNSPALSGEGEDLGASQPLSLGPTSCHPVPQQHPQAHVDIYEKQPVPFGL
VRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVPELQEAYHAVVLSYGAED
HRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGNVALDVARILLT
PPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIKELREMIQLPGARPILDPV
DFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAWGLRFFRSPQQVLPS
PDGRRAAGVRLAVTRLEGVDEATRAVPTGDMEDLPCGLVLSSIGYKSRPVDPSVPFDSKL
GVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQMLLQDLKAGLLPSGPRPG
YAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGTGKPREKLVDPQEMLRLLGH
Download sequence
Identical sequences A0A0A0MT64
ENSP00000416515 NP_001244941.2.87134 NP_001244941.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]