SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000416726 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000416726
Domain Number 1 Region: 43-96
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000000157
Family Arfaptin, Rac-binding fragment 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000416726   Gene: ENSG00000163596   Transcript: ENST00000454326
Sequence length 97
Comment pep:known chromosome:GRCh38:2:202821427:202870876:-1 gene:ENSG00000163596 transcript:ENST00000454326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSFGQPRPEDNQSVVRRMQKKYWKTKQVFIKATGKKEDEHLVASDAELDAKLEVFHSVQ
ETCTELLKIIEKYQLRLNVISEEENELGLFLKFQAER
Download sequence
Identical sequences ENSP00000416726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]