SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000416884 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000416884
Domain Number 1 Region: 213-437
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.91e-88
Family PDEase 0.00000107
Further Details:      
 
Domain Number 2 Region: 21-194
Classification Level Classification E-value
Superfamily GAF domain-like 1.96e-34
Family GAF domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000416884   Gene: ENSG00000128655   Transcript: ENST00000433879
Sequence length 437
Comment pep:novel chromosome:GRCh38:2:177675455:177905174:-1 gene:ENSG00000128655 transcript:ENST00000433879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLPFCGIAISNAQLFAASRKEYERSRALLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKCE
RCSVLLLEDIESPVVKFTKSFELMSPKCSADAENSFKESMEKSSYSDWLINNSIAELVAS
TGLPVNISDAYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFDD
ADQRLFEVLSYHATCSKAEVDKFKAANIPLVSELAIDDIHFDDFSLDVDAMITAALRMFM
ELGMVQKFKIDYETLCRWLLTVRKNYRMVLYHNWRHAFNVCQLMFAMLTTAGFQDILTEV
EILAVIVGCLCHDLDHRGTNNAFQAKSGSALAQLYGTSATLEHHHFNHAVMILQSEGHNI
FANLSSKEYSDLMQLLKQSILATDLTLYFERRTEFFELVSKGEYDWNIKNHRDIFRSMLM
TACDLGAVTKPWEISRQ
Download sequence
Identical sequences H7C4D0
ENSP00000416884 ENSP00000416884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]