SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000416900 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000416900
Domain Number 1 Region: 2-162
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.89e-40
Family WD40-repeat 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000416900   Gene: ENSG00000114742   Transcript: ENST00000441361
Sequence length 162
Comment pep:putative chromosome:GRCh38:3:39052301:39074749:1 gene:ENSG00000114742 transcript:ENST00000441361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHHTDWVNDIVLCCNGKTLISASSDTTVKVWNAHKGFCMSTLRTHKDYVKALAYAKDKE
LVASAGLDRQIFLWDVNTLTALTASNNTVTTSSLSGNKDSIYSLAMNQLGTIIVSGSTEK
VLRVWDPRTCAKLMKLKGHTDNVKALLLNRDGTQCLSGSSDG
Download sequence
Identical sequences A0A2J8WY54 C9JC24
ENSP00000416900 ENSP00000416900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]