SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000416917 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000416917
Domain Number 1 Region: 4-139
Classification Level Classification E-value
Superfamily SIS domain 0.000000000178
Family mono-SIS domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000416917   Gene: ENSG00000084734   Transcript: ENST00000411584
Sequence length 189
Comment pep:putative chromosome:GRCh38:2:27506510:27509791:1 gene:ENSG00000084734 transcript:ENST00000411584 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRAHQVTYSQSPKIATLMKSVSTSLEKKGHVYLVGWQTLGIIAIMDGVECIHTFGADFRD
VRGFLIGDHSDMFNQKAELTNQGPQFTFSQEDFLTSILPSLTEIDTVVFIFTLDDNLTEV
QTIVEQVKEKTNHIQALAHSTVGQTLLIPLKKLFPSIISITWPLLFFEYEGNFIQRSGFS
TLPRLFANS
Download sequence
Identical sequences H7C4D3
ENSP00000416917 ENSP00000416917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]