SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000417484 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000417484
Domain Number 1 Region: 68-118
Classification Level Classification E-value
Superfamily EF-hand 0.000000465
Family Polcalcin 0.068
Further Details:      
 
Domain Number 2 Region: 10-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000262
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417484   Gene: ENSG00000185055   Transcript: ENST00000486180
Sequence length 131
Comment pep:novel chromosome:GRCh38:7:105566323:105581486:-1 gene:ENSG00000185055 transcript:ENST00000486180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METSSRELQAAEYLEKHQIKEVVSYLTSALLFFRPEKPKEYLISLLERLRIAKVTGVAFP
FFMDNSNIVAMFEMMDSSGRGTISFVQYKEALKTLGLCTEDEDLQDDGHKITLDKFKEEV
NKRMKEIWSAF
Download sequence
Identical sequences J3KR48
ENSP00000417484 ENSP00000417484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]