SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000417574 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000417574
Domain Number 1 Region: 3-52
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.00000262
Family Regulator of chromosome condensation RCC1 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417574   Gene: ENSG00000156313   Transcript: ENST00000464437
Sequence length 129
Comment pep:putative chromosome:GRCh38:X:38298331:38301371:-1 gene:ENSG00000156313 transcript:ENST00000464437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XIGLMYTFGDGRHGKLGLGLENFTNHFIPTLCSNFLRFIVKLVACGGCHMVVFAAPHRGV
AKEIEFDEINDTCLSVATFLPYSSLTSGNVLQRTLSARMRRRERLSLMSSGSLYTINNEM
GKQRNKDFN
Download sequence
Identical sequences H7C4L1
ENSP00000417574 ENSP00000417574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]