SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000417736 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000417736
Domain Number 1 Region: 1-78
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.02e-20
Family FHA domain 0.00000817
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417736   Gene: ENSG00000112130   Transcript: ENST00000487950
Sequence length 205
Comment pep:putative chromosome:GRCh38:6:37354064:37369030:1 gene:ENSG00000112130 transcript:ENST00000487950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKEN
AEYEYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKIN
KVSCESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKAS
NSSASQRSLQMFKVTMSRILRLKIQ
Download sequence
Identical sequences C9J858
ENSP00000417736 ENSP00000417736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]