SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000417853 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000417853
Domain Number - Region: 78-139
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00977
Family Di-heme elbow motif 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000417853   Gene: ENSG00000186501   Transcript: ENST00000464813
Sequence length 147
Comment pep:putative chromosome:GRCh38:1:27322281:27334896:1 gene:ENSG00000186501 transcript:ENST00000464813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQYQGSGGVAMDVERSRFPYCVVWTPIPVLTWFFPIIGHMGICTSTGVIRDFAGPYFVS
EDNMAFGKPAKYWKLDPAQVYASGPNAWDTAVHDASEEYKHRMHNLCCDNCHSHVALALN
LMRYNNSTNWNMVTLCFFCLLYGKYVR
Download sequence
Identical sequences A0A2J8JNZ5 H0Y870
ENSP00000417853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]