SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000418107 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000418107
Domain Number 1 Region: 98-130,269-306
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000173
Family Anti-sigma factor antagonist SpoIIaa 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418107   Gene: ENSG00000112053   Transcript: ENST00000465492
Sequence length 320
Comment pep:known chromosome:GRCh38:6:35943695:35968895:-1 gene:ENSG00000112053 transcript:ENST00000465492 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XFYTLPNAVLAGIILSNVIPYLETISNLPSLWRQDQYDCALWMMTFSSSIFLGLDIGLII
SVVSAFFITTVRSHRAKILLLGQIPNTNIYRSINDYREIITIPGVKIFQCCSSITFVNVY
YLKHKLLKEVDMVKVPLKEEEIFSLFNSSDTNLQGGKICRCFCNCDDLEPLPRILYTERF
ENKLDPEASSINLIHCSHFESMNTSQTASEDQVPYTVSSVSQKNQGQQYEEVEEVWLPNN
SSRNSSPGLPDVAESQGRRSLIPYSDASLLPSVHTIILDFSMVHYVDSRGLVVLRQVSTE
EALAGALIPLLPSQPHPDPD
Download sequence
Identical sequences H7C4T4
ENSP00000418107 ENSP00000418107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]