SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000418367 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000418367
Domain Number 1 Region: 6-154
Classification Level Classification E-value
Superfamily vWA-like 3.89e-44
Family Integrin A (or I) domain 0.00000194
Further Details:      
 
Domain Number 2 Region: 144-233
Classification Level Classification E-value
Superfamily Integrin domains 6.8e-31
Family Integrin domains 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418367   Gene: ENSG00000082781   Transcript: ENST00000496703
Sequence length 263
Comment pep:novel chromosome:GRCh38:3:124796591:124841551:-1 gene:ENSG00000082781 transcript:ENST00000496703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKI
GWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQCHLNEANEYTASNQMDYPSLALLG
EKLAENNINLIFAVTKNHYMLYKSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKC
EGLKIGDTASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNS
ARCNGSGTYVCGLCECSPGYLGT
Download sequence
Identical sequences H7C4W1
ENSP00000418367 ENSP00000418367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]