SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000418370 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000418370
Domain Number 1 Region: 13-90
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 9.03e-31
Family eIF5a N-terminal domain-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418370   Gene: ENSG00000163577   Transcript: ENST00000474096
Sequence length 105
Comment pep:putative chromosome:GRCh38:3:170893349:170908644:-1 gene:ENSG00000163577 transcript:ENST00000474096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVG
IDIFTGKKYEDICPSTHNMDVPNIKRNDYQKLVKFVRILNCQKVN
Download sequence
Identical sequences F8WCJ1
ENSP00000418370 ENSP00000418370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]