SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000418425 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000418425
Domain Number - Region: 10-36
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.034
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418425   Gene: ENSG00000185055   Transcript: ENST00000460135
Sequence length 76
Comment pep:novel chromosome:GRCh38:7:105567195:105581690:-1 gene:ENSG00000185055 transcript:ENST00000460135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METSSRELQAAEYLEKHQIKEVVSYLTSALLFFRPALKTLGLCTEDEDLQDDGHKITLDK
FKEEVNKRMKEIWSAF
Download sequence
Identical sequences C9J654
ENSP00000418425 ENSP00000418425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]