SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000418583 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000418583
Domain Number 1 Region: 1-84
Classification Level Classification E-value
Superfamily HAD-like 1.57e-19
Family 5' nucleotidase-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418583   Gene: ENSG00000168268   Transcript: ENST00000471522
Sequence length 85
Comment pep:putative chromosome:GRCh38:3:52528021:52529944:-1 gene:ENSG00000168268 transcript:ENST00000471522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIDAFHYVQLGTAYRGLQPVPDEEGPSIKQFMDIFSLPEMALLSCVVDYFLGHSLEFDQ
AHLYKDVTDAIRDVHVKGLMYQWIE
Download sequence
Identical sequences A0A2J8P8B7 A0A2J8THU5 C9J036
ENSP00000418583 ENSP00000418583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]