SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000418709 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000418709
Domain Number 1 Region: 92-191
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.1e-21
Family Ubiquitin-related 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418709   Gene: ENSG00000164897   Transcript: ENST00000482202
Sequence length 246
Comment pep:known chromosome:GRCh38:7:151081484:151083400:-1 gene:ENSG00000164897 transcript:ENST00000482202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLIEGVGDEVTVLFSVLACLLVLALAWVSTHTAEGGDPLPQPSGTPTPSQPSAAMAATD
SMRGEAPGAETPSLRHRGQAAQPEPSTGFTATPPAPDSPQEPLVLRLKFLNDSEQVARAW
PHDTIGSLKRTQFPGREQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPNP
PCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLA
FAMYRP
Download sequence
Identical sequences A0A090N8Q3 G3RL64 H2R4V2 Q9BVT8
ENSP00000297533 ENSP00000376565 ENSP00000417519 ENSP00000418709 ENSP00000419214 NP_001129516.1.87134 NP_001129516.1.92137 NP_113622.1.87134 NP_113622.1.92137 XP_003318965.1.37143 XP_003951243.1.37143 XP_018886388.1.27298 gi|13899257|ref|NP_113622.1| gi|209862889|ref|NP_001129516.1| 9606.ENSP00000297533 ENSPTRP00000047550 ENSPTRP00000047550 ENSP00000297533 ENSP00000297533 ENSP00000376565 ENSP00000417519 ENSP00000418709 ENSP00000419214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]