SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000418725 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000418725
Domain Number 1 Region: 24-86
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000157
Family Plexin repeat 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSP00000418725
Domain Number - Region: 99-147
Classification Level Classification E-value
Superfamily Integrin domains 0.0126
Family Integrin domains 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000418725   Gene: ENSG00000150093   Transcript: ENST00000488494
Sequence length 152
Comment pep:novel chromosome:GRCh38:10:32928193:32958227:-1 gene:ENSG00000150093 transcript:ENST00000488494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSVSKTFLQEG
MPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQ
QLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLM
Download sequence
Identical sequences E7EUI6
ENSP00000418725 ENSP00000418725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]