SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000419081 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000419081
Domain Number 1 Region: 41-189
Classification Level Classification E-value
Superfamily EF-hand 9.22e-38
Family Calmodulin-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419081   Gene: ENSG00000129007   Transcript: ENST00000467889
Sequence length 196
Comment pep:known chromosome:GRCh38:15:68193804:68205561:-1 gene:ENSG00000129007 transcript:ENST00000467889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEHLLPGPPPSLADFRLEAGGKGTERGSGSSKPTGSSRGPRMAKFLSQDQINEYKECF
SLYDKQQRGKIKATDLMVAMRCLGASPTPGEVQRHLQTHGIDGNGELDFSTFLTIMHMQI
KQEDPKKEILLAMLMVDKEKKGYVMASDLRSKLTSLGEKLTHKEVDDLFREADIEPNGKV
KYDEFIHKITLPGRDY
Download sequence
Identical sequences Q96GE6
9606.ENSP00000419081 gi|110227594|ref|NP_219501.2| NP_219501.2.87134 NP_219501.2.92137 ENSP00000400755 ENSP00000419081 ENSP00000419081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]