SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000419197 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000419197
Domain Number 1 Region: 2-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-20
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419197   Gene: ENSG00000197008   Transcript: ENST00000494380
Sequence length 126
Comment pep:putative chromosome:GRCh38:7:64794425:64831803:1 gene:ENSG00000197008 transcript:ENST00000494380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLTFMDVAIEFSLEEWQCLDTAQRNVYRHVMLENYRNLVFLDLITCLEQGKEPWNMKR
HEMVVAKHSAVAFTFDLSGLNILSFQSILPFVSALYVMGNRNQCLQKHLEARNKDLCVLV
LPKTFG
Download sequence
Identical sequences A0A0A0MT90
NP_001153655.1.87134 NP_001153655.1.92137 ENSP00000419197 gi|237512951|ref|NP_001153655.1| ENSP00000419197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]