SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000419212 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000419212
Domain Number - Region: 29-88
Classification Level Classification E-value
Superfamily SNF-like 0.0327
Family SNF-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419212   Gene: ENSG00000102312   Transcript: ENST00000489940
Sequence length 97
Comment pep:known chromosome:GRCh38:X:48509030:48511451:1 gene:ENSG00000102312 transcript:ENST00000489940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATFSRQEFFQQLLQGCLLPTAQQGLDQIWLLLAICLACRLLWRLGLPSYLKHASTVAGG
FFSLYHFFQLHMVWVVLLSLLCYLVLFLCRHSSHRGV
Download sequence
Identical sequences A0A2J8IQQ4 A0A2J8R8Q0 C9JWI5
ENSP00000419212 ENSP00000470789 ENSP00000419212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]