SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000419266 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000419266
Domain Number 1 Region: 167-241
Classification Level Classification E-value
Superfamily Homeodomain-like 1.97e-24
Family Homeodomain 0.0000915
Further Details:      
 
Weak hits

Sequence:  ENSP00000419266
Domain Number - Region: 328-374
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0272
Family Cytochrome c3-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419266   Gene: ENSG00000106038   Transcript: ENST00000496902
Sequence length 407
Comment pep:known chromosome:GRCh38:7:27242700:27246573:1 gene:ENSG00000106038 transcript:ENST00000496902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESRKDMVVFLDGGQLGTLVGKRVSNLSEAVGSPLPEPPEKMVPRGCLSPRAVPPATRER
GGGGPEEEPVDGLAGSAAGPGAEPQVAGAAMLGPGPPAPSVDSLSGQGQPSSSDTESDFY
EEIEVSCTPDCATGNAEYQHSKGSGSEALVGSPNGGSETPKSNGGSGGGGSQGTLACSAS
DQMRRYRTAFTREQIARLEKEFYRENYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKR
QRLAMTWPHPADPAFYTYMMSHAAAAGGLPYPFPSHLPLPYYSPVGLGAASAASAAASPF
SGSLRPLDTFRVLSQPYPRPELLCAFRHPPLYPGPAHGLGASAGGPCSCLACHSGPANGL
APRAAAASDFTCASTSRSDSFLTFAPSVLSKASSVALDQREEVPLTR
Download sequence
Identical sequences P49640
ENSP00000419266 9606.ENSP00000419266 NP_001980.1.87134 NP_001980.1.92137 ENSP00000419266 gi|4503615|ref|NP_001980.1| ENSP00000419266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]