SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000419388 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000419388
Domain Number 1 Region: 28-140
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.84e-33
Family Single strand DNA-binding domain, SSB 0.000000699
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419388   Gene: ENSG00000106028   Transcript: ENST00000484178
Sequence length 148
Comment pep:known chromosome:GRCh38:7:141738600:141750461:1 gene:ENSG00000106028 transcript:ENST00000484178 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRRPVLQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLA
TNEMWRSGDSEVYQLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLEGKIDYGEYM
DKNNVRRQATTIIADNIIFLSDQTKEKE
Download sequence
Identical sequences A4D1U3 G3R2E1 H2QVI4 Q04837
ENSP00000265304 ENSP00000419388 ENSP00000419541 ENSP00000419665 ENSP00000420485 ENSP00000458815 ENSP00000459208 ENSP00000459367 ENSP00000460028 ENSP00000461884 ENSGGOP00000009389 NP_001243439.1.87134 NP_001243439.1.92137 NP_001243440.1.87134 NP_001243440.1.92137 NP_001243441.1.87134 NP_001243441.1.92137 NP_001243442.1.87134 NP_001243442.1.92137 NP_003134.1.87134 NP_003134.1.92137 XP_001156319.1.37143 XP_001156384.1.37143 XP_001156496.1.37143 XP_001156549.1.37143 XP_003813422.1.60992 XP_003813423.1.60992 XP_003813424.1.60992 XP_003813425.1.60992 XP_004046377.1.27298 XP_004046380.1.27298 XP_016800978.1.37143 XP_016800980.1.37143 XP_016800981.1.37143 XP_016800982.1.37143 399810 ENSPTRP00000033880 gi|4507231|ref|NP_003134.1| 9598.ENSPTRP00000033880 9606.ENSP00000265304 ENSPTRP00000033880 ENSGGOP00000009389 ENSP00000265304 ENSP00000458403 ENSP00000265304 ENSP00000419388 ENSP00000419541 ENSP00000419665 ENSP00000420485 ENSP00000480488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]