SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000419399 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000419399
Domain Number 1 Region: 11-191
Classification Level Classification E-value
Superfamily Rhomboid-like 1.7e-19
Family Rhomboid-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419399   Gene: ENSG00000099958   Transcript: ENST00000476077
Sequence length 205
Comment pep:known chromosome:GRCh38:22:23836734:23839012:-1 gene:ENSG00000099958 transcript:ENST00000476077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWQGLAAEFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTN
FLFFGPLGFSFFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSLFFL
GQALMAMLVYVWSRRSPRVRVNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGH
IYYFLEDVFPNQPGGKRLLQTPGFL
Download sequence
Identical sequences ENSP00000419399 ENSP00000483251 gi|50845409|ref|NP_940842.2| NP_940842.2.87134 NP_940842.2.92137 ENSP00000419399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]