SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000419679 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000419679
Domain Number - Region: 38-69
Classification Level Classification E-value
Superfamily UBA-like 0.000126
Family UBA domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419679   Gene: ENSG00000013374   Transcript: ENST00000480714
Sequence length 128
Comment pep:putative chromosome:GRCh38:7:151368830:151374624:1 gene:ENSG00000013374 transcript:ENST00000480714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRACDGNVDHAATHITNRREELAQIRKEEKEKKRRRLENIRFLKGMGYSTHAAQQVLHAA
SGNLDEALKVAAPSGPLALSLSSGSCPELPPWLSSILPGSLLWAAPSSGSEGQVSPGLQP
RHRLREAT
Download sequence
Identical sequences H7C5E1
ENSP00000419679 ENSP00000419679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]