SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000419688 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000419688
Domain Number 1 Region: 1-41
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000208
Family Ephrin receptor ligand binding domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419688   Gene: ENSG00000154928   Transcript: ENST00000497173
Sequence length 42
Comment pep:putative chromosome:GRCh38:3:134796141:134951441:1 gene:ENSG00000154928 transcript:ENST00000497173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQVCNVF
Download sequence
Identical sequences A0A2J8QJ10 A0A2J8S2B5 C9K090
ENSP00000419688 ENSP00000419688

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]