SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000419761 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000419761
Domain Number 1 Region: 3-186
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.12e-43
Family RNA helicase 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000419761   Gene: ENSG00000174953   Transcript: ENST00000469977
Sequence length 188
Comment pep:novel chromosome:GRCh38:3:154284653:154295327:-1 gene:ENSG00000174953 transcript:ENST00000469977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XIPLHSLMPTVNQTQVFKRTPPGVRKIVIATNIAETSITIDDVVYVIDGGKIKETHFDTQ
NNISTMSAEWVSKANAKQRKGRAGRVQPGHCYHLYNGLRASLLDDYQLPEILRTPLEELC
LQIKNALDKQEELTPLGVHLARLPVEPHIGKMILFGALFCCLDPVLTIAASLSFKDPFVI
PLGKEKIA
Download sequence
Identical sequences ENSP00000419761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]