SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000420282 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000420282
Domain Number - Region: 81-98
Classification Level Classification E-value
Superfamily vWA-like 0.000378
Family Integrin A (or I) domain 0.0064
Further Details:      
 
Domain Number - Region: 39-97
Classification Level Classification E-value
Superfamily Integrin domains 0.000476
Family Integrin domains 0.0064
Further Details:      
 
Domain Number - Region: 4-26
Classification Level Classification E-value
Superfamily Plexin repeat 0.0256
Family Plexin repeat 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420282   Gene: ENSG00000150093   Transcript: ENST00000474568
Sequence length 98
Comment pep:putative chromosome:GRCh38:10:32928174:32958232:-1 gene:ENSG00000150093 transcript:ENST00000474568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQ
QLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSM
Download sequence
Identical sequences A0A2J8U388 C9JPK5
ENSP00000420282 ENSP00000420282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]