SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000420367 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420367
Domain Number 1 Region: 50-193
Classification Level Classification E-value
Superfamily Cupredoxins 8.62e-52
Family Multidomain cupredoxins 0.000000107
Further Details:      
 
Domain Number 2 Region: 3-42
Classification Level Classification E-value
Superfamily Cupredoxins 0.0000000000476
Family Multidomain cupredoxins 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420367   Gene: ENSG00000047457   Transcript: ENST00000479771
Sequence length 225
Comment pep:putative chromosome:GRCh38:3:149162417:149179621:-1 gene:ENSG00000047457 transcript:ENST00000479771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAGTEDSACIPWAYYSTVDQVKDLYSGLIGPLIVCRRPYLKVFNPRRKLEFALLFLVFDE
NESWYLDDNIKTYSDHPEKVNKDDEEFIESNKMHAINGRMFGNLQGLTMHVGDEVNWYLM
GMGNEIDLHTVHFHGHSFQYKHRGVYSSDVFDIFPGTYQTLEMFPRTPGIWLLHCHVTDH
IHAGMETTYTVLQNEASSETHRRIWNVIYPITVSVIILFQISTKE
Download sequence
Identical sequences H7C5N5
ENSP00000420367 ENSP00000420367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]