SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000420700 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420700
Domain Number 1 Region: 3-105
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000000146
Family Ankyrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420700   Gene: ENSG00000144802   Transcript: ENST00000477601
Sequence length 130
Comment pep:novel chromosome:GRCh38:3:101855733:101859527:1 gene:ENSG00000144802 transcript:ENST00000477601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELLLKNKSLVDTIKCLIQMGAAVEAKAYN
GNTALHVAASLQYRLTQLDAVRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKG
KSIQQRAPPY
Download sequence
Identical sequences H7C5S1
ENSP00000420700 ENSP00000420700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]