SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000420862 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000420862
Domain Number - Region: 3-65
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000241
Family Myosin rod fragments 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420862   Gene: ENSG00000242715   Transcript: ENST00000506800
Sequence length 91
Comment pep:known chromosome:GRCh38:13:36227120:36297749:-1 gene:ENSG00000242715 transcript:ENST00000506800 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MPVESLNTLLKQLEEEKKTLESQVKYYALKLEQESKAYQKINNERRTYLAEMSQGSGLHQ
VSKRQQVDQLPRMQENLVKTFKVTKSPKGRK
Download sequence
Identical sequences E9PBZ7
ENSP00000420862 ENSP00000420862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]