SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000420894 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000420894
Domain Number 1 Region: 46-106
Classification Level Classification E-value
Superfamily occludin/ELL-like 3.66e-22
Family Occludin/ELL domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000420894   Gene: ENSG00000118985   Transcript: ENST00000508757
Sequence length 137
Comment pep:putative chromosome:GRCh38:5:95890949:95898317:-1 gene:ENSG00000118985 transcript:ENST00000508757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEEKEEDLKREEEIAKLNNSSPNSSGGVKEDCTASMEPSAIELPDYLIKYIAIVSYEQRQ
NYKDDFNAEYDEYRALHARMETVARRFIKLDAQRKRLSPGSKEYQVNGFVTRWADFHILP
SFFPCPAQPQPSQWPLE
Download sequence
Identical sequences H0Y8G1
ENSP00000420894 ENSP00000420894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]