SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000421095 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000421095
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.97e-17
Family Voltage-gated potassium channels 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000421095   Gene: ENSG00000080709   Transcript: ENST00000505491
Sequence length 95
Comment pep:known chromosome:GRCh38:5:114433578:114493442:1 gene:ENSG00000080709 transcript:ENST00000505491 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHN
FMMDTQLTKRGKEDHGDNNCNTRWRTQHPLIKKKK
Download sequence
Identical sequences D6RGY7
ENSP00000421095 ENSP00000421095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]