SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000421177 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000421177
Domain Number 1 Region: 35-195
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 4.97e-62
Family Inorganic pyrophosphatase 0.0000053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000421177   Gene: ENSG00000138777   Transcript: ENST00000504028
Sequence length 195
Comment pep:novel chromosome:GRCh38:4:105424249:105474059:-1 gene:ENSG00000138777 transcript:ENST00000504028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALLRLLRTGAPAAACLRLGTSAGTGSRRAMALYHTEERGQPCSQNYRLFFKNVTGHYI
SPFHDIPLKENGIPMKKARNDEYENLFNMIVEIPRWTNAKMEIATKEPMNPIKQYVKDGK
LRYVANIFPYKGYIWNYGTLPQTWEDPHEKDKSTNCFGDNDPIDVCEIGSKILSCGEVIH
VKILGILALIDEGET
Download sequence
Identical sequences A0A2J8M2P8 A0A2J8XQL8 D6RGV9
ENSP00000421177 ENSP00000421177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]