SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000421756 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000421756
Domain Number 1 Region: 6-127
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 0.0000000000000392
Family Diacylglycerol kinase-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000421756   Gene: ENSG00000145214   Transcript: ENST00000515182
Sequence length 157
Comment pep:novel chromosome:GRCh38:4:960615:962440:-1 gene:ENSG00000145214 transcript:ENST00000515182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKIVQMSNYCGIGIDAELSLDFHQAREEEPGKFTSSWGSGADLWGSDSDTRFEKPRMDDG
LLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKATPVQVDGEPWVQAPGHMIISA
AGPKVHMLRKAKQKPRRAGTTRDARADAAPAPESDPR
Download sequence
Identical sequences H0Y8Q7
ENSP00000421756 ENSP00000421756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]