SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000422063 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000422063
Domain Number 1 Region: 28-100
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000055
Family FAD-linked reductases, N-terminal domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000422063   Gene: ENSG00000145882   Transcript: ENST00000510990
Sequence length 111
Comment pep:known chromosome:GRCh38:5:149358037:149365971:1 gene:ENSG00000145882 transcript:ENST00000510990 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MARAAPLLAALTALLAAAAAGGDAPPGKIAVVGAGIGGSAVAHFLQQHFGPRVQIDVYEK
GTVGGRLATISVNKQHYESGAASFHSLSLHMQDFVKLLDGATETREGKELA
Download sequence
Identical sequences A0A2I3LN96 A0A2K5WXJ5 D6R9J0
ENSP00000422063 ENSP00000422063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]